PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_5100A9609.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 132aa    MW: 15298.8 Da    PI: 10.2529
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_5100A9609.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.8e-151461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++lv     +G  +W+ +++  g+ R++k+c++rw +yl
  Traes_7DS_5100A9609.1 14 KGPWTAEEDQKLVGFLLTHGHYCWRVVPKLAGLLRCGKSCRLRWTNYL 61
                           79******************99**********99************97 PP

2Myb_DNA-binding56.37.4e-1870111447
                            S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             + eE++l +d+++qlG++ W++Ia+ ++ gRt++++k++w+++
  Traes_7DS_5100A9609.1  70 LSDEEQQLVIDLHAQLGNR-WSKIAAQLP-GRTDNEIKNHWNTH 111
                            589****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-21562IPR009057Homeodomain-like
PROSITE profilePS5129414.043961IPR017930Myb domain
SuperFamilySSF466899.39E-2811108IPR009057Homeodomain-like
SMARTSM007175.3E-111363IPR001005SANT/Myb domain
PfamPF002492.2E-131461IPR001005SANT/Myb domain
CDDcd001672.44E-81661No hitNo description
PROSITE profilePS5129427.85662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-2663116IPR009057Homeodomain-like
SMARTSM007173.1E-1566114IPR001005SANT/Myb domain
PfamPF002491.7E-1570111IPR001005SANT/Myb domain
CDDcd001671.40E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVGFLL THGHYCWRVV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDEEQQLVID LHAQLGNRWS KIAAQLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPVTHRPLD QE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0089810.0BT008981.2 Triticum aestivum clone wdk2c.pk006.d4:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452601.13e-86hypothetical protein SORBIDRAFT_04g028850
SwissprotQ50EX61e-81ODO1_PETHY; Protein ODORANT1
TrEMBLM8C0412e-94M8C041_AEGTA; Protein ODORANT1
STRINGMLOC_14021.11e-93(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-84myb domain protein 20